Everything below concerns dual agonist. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2026-01-27. Where a claim depends on a specific study, the study is described rather than over-claimed.
Structure-activity work shows that fatty acid length, linker chemistry and the position of acylation all influence albumin affinity and receptor potency. Plasma protein binding exceeds 99 percent, which restricts distribution and slows renal clearance. Degradation proceeds largely through general proteolysis and fatty acid oxidation rather than cytochrome P450 metabolism, so exposure to common oxidative drug interactions is limited. Whether these clearance routes vary meaningfully between individuals is not fully established.
The molecule is a synthetic 39-amino-acid peptide whose backbone derives from the sequence of human glucose-dependent insulinotropic polypeptide, with several substitutions that raise metabolic stability and shift receptor preference. A C20 fatty diacid is attached through a short linker to a lysine side chain, a modification that increases binding to serum albumin. The reported monoisotopic mass is approximately 4813 Da. Near neutral pH the peptide carries a net negative charge, and the lipid tail makes the molecule markedly more hydrophobic than the unmodified parent sequence.
Dual agonism at the GIP and GLP-1 receptors underlies the observed pharmacology. Activation of GLP-1 receptors raises glucose-dependent insulin release, lowers glucagon secretion, slows gastric emptying and reduces appetite. GIP receptor activation contributes additional effects on adipose tissue and on energy balance, and the combined action on appetite appears larger than either pathway alone in animal models. Signalling bias and the relative contribution of each receptor arm to weight-related effects remain areas of active investigation.
Both receptors are class B G protein-coupled receptors that signal largely through Gs-mediated cyclic AMP production. Activation within pancreatic islets increases glucose-dependent insulin secretion and suppresses glucagon release when glucose is elevated. Outside the pancreas, signaling in the central nervous system and gut appears to influence appetite and gastric emptying. The relative contribution of each receptor to observed clinical effects remains under investigation, and the two pathways are not simply additive in practice.
Reported outcomes in large trials include dose-dependent weight reduction and improvements in glycemic markers over periods ranging from several months to more than a year. Whether the compound alters long-term cardiovascular or renal outcomes is being examined in dedicated outcome studies, so those questions remain open. Labeling describes gastrointestinal effects such as nausea and diarrhea, which tend to appear during dose escalation. Discontinuation rates and the durability of effects after treatment stops vary across study populations and are still debated.
Tirzepatide is a synthetic peptide developed as a dual agonist at the glucose-dependent insulinotropic polypeptide and glucagon-like peptide-1 receptors. Its structure is built on a GIP-derived backbone with non-natural amino acid substitutions and a fatty diacid side chain that promotes albumin binding and slows clearance. That modification supports once-weekly subcutaneous dosing. Registrational trial programs reported reductions in body weight and glycated hemoglobin alongside the drug's glycemic effects.
| Property | Value | Notes |
|---|---|---|
| Molar mass | approximately 4813 Da | calculated from the 39-residue sequence |
| Appearance | white to off-white powder | typical of lyophilised peptide material |
| Solubility class | freely soluble in water | measured value depends on salt form and pH |
| Plasma protein binding | >99 percent | linked to the fatty diacid side chain |
| Class | dual GIP and GLP-1 receptor agonist | receptor activity varies with the assay used |
Tirzepatide is a synthetic peptide of 39 amino acids that carries a C20 fatty diacid side chain attached through a linker. Its molecular formula is C225H348N48O68, and its molecular weight is about 4813 daltons. The compound belongs to the incretin mimetic class and is administered by subcutaneous injection. The fatty acid chain promotes binding to serum albumin, which slows renal clearance and extends the circulation time of the molecule. It was identified during screening of sequences derived from glucose-dependent insulinotropic polypeptide.
Tirzepatide activates both the glucose-dependent insulinotropic polypeptide receptor and the glucagon-like peptide-1 receptor, making it a dual agonist rather than a selective agent. Engagement of the GLP-1 receptor is linked to glucose-dependent insulin release, slower gastric emptying, and reduced appetite signalling. The relative contribution of the GIP arm remains an active research question; proposed roles include improved insulin sensitivity and altered adipose tissue handling. Receptor occupancy studies suggest the molecule interacts with both targets at circulating concentrations achieved during therapy.
The GIP receptor is expressed in pancreatic islets, adipose tissue, and the central nervous system, while GLP-1 receptors are found in pancreatic islets, the gastrointestinal tract, and the brain. Activation of both receptors can enhance glucose-dependent insulin secretion and reduce glucagon release. The relative contribution of each receptor to the overall pharmacological effect remains an area of ongoing investigation. Preclinical studies suggest that GIP receptor agonism may modulate appetite and energy balance, but the precise mechanisms in humans are not fully established.
In clinical research, tirzepatide has been studied in randomized controlled trials for glycemic control and body weight reduction. These trials typically measure changes in hemoglobin A1c and body weight over periods of several months. The drug is administered by subcutaneous injection, and its pharmacokinetic profile supports once-weekly dosing. Post-marketing surveillance continues to evaluate long-term outcomes and rare adverse events.
Tirzepatide is a synthetic peptide that acts as a dual agonist at the glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors. The molecule contains 39 amino acids and features a C20 fatty diacid moiety attached via a linker, which promotes albumin binding and extends its circulating half-life. Its sequence incorporates non-natural amino acids and modifications that reduce susceptibility to degradation by dipeptidyl peptidase-4. This dual receptor activity distinguishes it from selective GLP-1 receptor agonists.
An extended fatty diacid moiety promotes binding to serum albumin, which slows renal clearance and extends the circulating half-life to roughly five days. That property supports once-weekly administration and largely explains the dosing interval described in clinical reports. Published data come mainly from large randomised programmes that evaluated glycaemic control and body weight over periods of many months. Long-term outcomes beyond those trial windows, including what happens after treatment stops, remain an active area of investigation.
Tirzepatide is a synthetic peptide built from thirty-nine amino acids. Its sequence is derived from native glucose-dependent insulinotropic polypeptide, or GIP, with several non-natural residues and a fatty diacid side chain attached through a linker. The molecule behaves as a dual agonist at two incretin receptors, GIP and GLP-1, instead of targeting a single receptor. This dual engagement separates it from earlier single-receptor incretin compounds and underpins most of its reported pharmacological activity.
At the receptor level, the compound binds both GIP and GLP-1 receptors and triggers downstream signalling that raises cyclic AMP in target cells. GLP-1 receptor activation is associated with glucose-dependent insulin release, slower gastric emptying, and reduced appetite signalling. GIP receptor activation contributes effects that are less completely characterised, and how much each receptor adds to the overall clinical response is still an open question. The two pathways appear to interact in a complementary rather than a purely additive way.
Clinical development proceeded through large phase 3 programmes in type 2 diabetes and in obesity or overweight with at least one weight-related comorbidity. Regulatory approvals followed in several jurisdictions for both indications. Weekly subcutaneous dosing reflects an elimination half-life of roughly five days. Open questions include the durability of metabolic effects after treatment stops, long-term cardiovascular and hepatic outcomes beyond completed trials, and whether the dual mechanism confers benefits independent of total receptor occupancy. Published literature continues to expand on these points. Substantial uncertainty remains about interindividual variability in response.
Tirzepatide is a synthetic linear peptide of 39 amino acids that acts as a dual agonist at the glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors. Its sequence derives from native GIP but incorporates non-natural residues and a C20 fatty diacid moiety linked to a lysine side chain. The lipophilic chain promotes albumin binding, which slows renal clearance and extends circulation time. The unmodified peptide has a molecular formula of C225H348N48O68 and a molecular mass near 4,813 daltons.
Deborah Levy (born 6 August 1959); novelist, playwright and poet of South African and Lithuanian Jewish ancestry; her plays were staged by the Royal Shakespeare Company; novels included Beautiful Mutants, Swallowing Geography and Billy & Girl; recent fiction has included the Booker-shortlisted novels Swimming Home and Hot Milk, as well as the Booker-longlisted The Man Who Saw Everything and short-story collection Black Vodka;The Guardian ranked The Cost of Living number 84 in list of "The 100 best books of the 21st century". Gertrude Rachel Levy (5 November 1883 – 10 October 1966), author and cultural historian writing about comparative mythology, matriarchy, epic poetry and archaeology; worked with Department of Antiquities in Mandatory Palestine. Paul Levy, food writer, biographer; long rabbinical pedigree Bernard Lewis (31 May 1916 – 19 May 2018); specialised in Oriental studies; public intellectual and political commentator; wrote over ten books on history of Islam and the interaction between Islam and the West; was called "the West's leading interpreter of the Middle East". Others have accused Lewis of having revived the image of cultural inferiority of Islam and of emphasising the dangers of jihad. His advice was frequently sought by neoconservative policymakers, including the Bush administration. However, his active support of the Iraq War and neoconservative ideals have since come under scrutiny. Maureen Lipman, (born 10 May 1946) is an English actress, columnist and comedian, who has published several collections of her comedy sketches, and autobiography.
Albumin is a protein made specifically by the liver, and can be measured cheaply and easily. It is the main constituent of total protein (the remaining constituents are primarily globulins). Albumin levels are decreased in chronic liver disease, such as cirrhosis. It is also decreased in nephrotic syndrome, where it is lost through the urine. The consequence of low albumin can be edema since the intravascular oncotic pressure becomes lower than the extravascular space. An alternative to albumin measurement is prealbumin, which is better at detecting acute changes (half-life of albumin and prealbumin is about 2 weeks and about 2 days, respectively).
== Trade names == Common trade names include Centrac, Centrax, Demetrin, Lysanxia, Mono Demetrin, Pozapam, Prasepine, Prazene, Reapam and Trepidan. Trade names vary depending on the country; Austria: Demetrin, Belgium: Lysanxia, France: Lysanxia, Germany: Demetrin; Mono Demetrin, Greece: Centrac, Ireland: Centrax, Italy: Prazene; Trepidan, Macedonia: Demetrin, Prazepam, Netherlands: Reapam, Portugal: Demetrin, South Africa: Demetrin, Switzerland: Demetrin, Thailand: Pozapam; Prasepine.
== Recommended storage temperature == The cold chain has been one of the most reliable supply chains for transporting vaccines around the globe. Since vaccines are sensitive biological products, proper storage and handling of vaccines are important to ensure the potency of vaccines is not lost. Vaccines must be continuously monitored as each has different reactivity to low temperature, high temperature, and light. The majority of vaccines required storage temperature of +35° to +46 °F (+2° to +8 °C) and must not be exposed to freezing temperature. Temperature too cold can result in an irreversible reaction that reduces vaccines potency and loss in adjuvant effect. Certain vaccines contain adjuvants (aluminum) that will precipitate when exposed to freezing temperatures. Temperature too hot could also result in wanted viruses permanently degrading and losing potency. However, the effects are usually smaller, gradual, and predictable than from freezing temperatures. Visible signs of physical changes after exposure to undesirable temperature are not necessary to result in a decrease of vaccine potency.
Sources: en.wikipedia.org
=== Alternatives === There is strong evidence that chlorhexidine and alcohol used to clean skin prior to surgery is better than any formulation of povidone-iodine. While the 2016 World Health Organization guidelines recommended alcohol-based CHG Chlorhexidine for surgical skin preparation based on low-to-moderate quality evidence, subsequent clinical data has clarified this comparison. A large-scale 2024 non-inferiority trial involving over 3,300 patients undergoing cardiac or abdominal surgeries found that alcohol-based povidone-iodine is non-inferior to alcohol-based CHG Chlorhexidine in preventing surgical site infections (SSIs).
=== NADP+ === NADP+ differs from NAD+ only in the addition of a phosphate group to the adenosine 5-membered carbon ring. The addition of the phosphate does not alter the electron transport abilities of the carrier. The phosphate group creates enough contrast between the two groups that they bind to the active site of different enzymes, generally catalyzing different types of reactions. These two electron carriers are easily distinguished by enzymes and participate in very different reactions. NADP+ mainly functions with enzymes that catalyze anabolic, or biosynthetic, pathways. Specifically, NADPH will act as a reducing agent in these reactions, resulting in NADP+. These are pathways that convert substrates to more complicated products, using ATP. The reasoning behind having two separate electron carriers for anabolic and catabolic pathways relates to regulation of metabolism. The ratio of NADP+ to NADPH in the cell is kept rather low, so that NADPH is readily available as a reducing agent; it is more commonly used as a reducing agent than NADP+ is used as an oxidizing agent.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
Sources: en.wikipedia.org
=== Exercise === It is recommended that hypermobile individuals remain fit, to prevent pain and fatigue. Regular exercise and exercise that is supervised by a physician and physical therapist can reduce symptoms because strong muscles increase dynamic joint stability. Low-impact exercise such as closed kinetic chain exercises are usually recommended as they are less likely to cause injury when compared to high-impact exercise or contact sports. Hydrotherapy can also be a beneficial medium for muscle training. Some isometric exercises can also be beneficial. Coordination may be improved through balance exercises. High impact sports are not recommended.
Several neurotoxins, both natural and synthetic, function by blocking the action potential. Tetrodotoxin from the pufferfish and saxitoxin from the Gonyaulax (the dinoflagellate genus responsible for "red tides") block action potentials by inhibiting the voltage-sensitive sodium channel; similarly, dendrotoxin from the black mamba snake inhibits the voltage-sensitive potassium channel. Such inhibitors of ion channels serve an important research purpose, by allowing scientists to "turn off" specific channels at will, thus isolating the other channels' contributions; they can also be useful in purifying ion channels by affinity chromatography or in assaying their concentration. However, such inhibitors also make effective neurotoxins, and have been considered for use as chemical weapons. Neurotoxins aimed at the ion channels of insects have been effective insecticides; one example is the synthetic permethrin, which prolongs the activation of the sodium channels involved in action potentials. The ion channels of insects are sufficiently different from their human counterparts that there are few side effects in humans.
Leader of Majority party/Opposition Leader in parliament, former Running Mate for APC, former Deputy Speaker of Parliament of Sierra Leone; former chairman of the Mines and Minerals Resources Committee. Sierra Leone. Alhaji Lamrana Bah – Businessman, Sierra Leone Abubakarr Jalloh – Politician, former Minister of Mineral Resource, Sierra Leone Amadu Jalloh – Politician, Sierra Leone Minkailu Bah – politician and Lecturer, former Minister of Education, Youth and Sports, Sierra Leone Mariama Jalloh Singer–Songwriter, Sierra Leone, Germany Mohamed Bailor Barrie was a prominent businessman in Sierra Leone's diamond trade in the 70s and 80s Hardy Caprio- Real name Hardy Tayyib-Bah, a British singer, songwriter and record producer Fankaty Dabo Idris Kanu, Footballer Mohamed Kanu Mahmadu Alphajor Bah Yayah Jalloh
Important properties of such local options are that they provide an optimal wound healing environment, while providing a constant local low dose release of ibuprofen while worn. If local treatment does not provide adequate pain reduction, it may be necessary for patients with chronic painful wounds to be prescribed additional systemic treatment for the physical component of their pain. Clinicians should consult with their prescribing colleagues referring to the WHO pain relief ladder of systemic treatment options for guidance. For every pharmacological intervention there are possible benefits and adverse events that the prescribing clinician will need to consider in conjunction with the wound care treatment team.
Sources: en.wikipedia.org
It is a synthetic peptide of 39 amino acids bearing a lipid side chain. Its size and architecture place it outside the small-molecule class, and laboratories generally handle it with the precautions used for biologic-like molecules.
The fatty diacid side chain promotes strong binding to serum albumin, which slows clearance and yields a half-life of roughly five days. That profile supports once-weekly administration in clinical use.
In vitro assays detect activity at both the GIP and GLP-1 receptors, but the activity ratio depends on the assay system and the signalling pathway measured. The relative contribution of each receptor to clinical effects is still being characterised.
It acts as an agonist at both the GIP and GLP-1 receptors, two related class B G protein-coupled receptors. This dual activity distinguishes it from single-receptor GLP-1 agonists. The clinical consequences of engaging both receptors are still being characterized.